(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIQ

AM180355.FLIQ        Location/Qualifiers
FT   CDS             321622..321891
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="CD630_02610"
FT                   /old_locus_tag="CD0261"
FT                   /product="Flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67083"
FT                   /db_xref="GOA:Q18D00"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D00"
FT                   /protein_id="CAJ67083.1"
FT                   /translation="MSEFMIMSVLKNGMFTGAMIAAPVLIVSLVVGLLISVFQATTQIQ
FT                   EQTLTFVPKLIAILLVVAIGGSWMLHTLISFTSEIFNMISLITK"
     MSEFMIMSVL KNGMFTGAMI AAPVLIVSLV VGLLISVFQA TTQIQEQTLT FVPKLIAILL        60
     VVAIGGSWML HTLISFTSEI FNMISLITK                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page