(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIS2

AM180355.FLIS2       Location/Qualifiers
FT   CDS             298599..298952
FT                   /transl_table=11
FT                   /gene="fliS2"
FT                   /locus_tag="CD630_02360"
FT                   /old_locus_tag="CD0236"
FT                   /product="Flagellar protein FliS2"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67057"
FT                   /db_xref="GOA:Q18CX1"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CX1"
FT                   /protein_id="CAJ67057.1"
FT                   /translation="MMELDLNELNGLSKEELLLMLVDGTVKYTNISKVALLNKDYLKAH
FT                   NELVRVQNIFTELMVTLDQSVGQWAKDMYKVYEFIKHELVKADINKDIKIIDDILPIVE
FT                   QIRDTWHEVYNKL"
     MMELDLNELN GLSKEELLLM LVDGTVKYTN ISKVALLNKD YLKAHNELVR VQNIFTELMV        60
     TLDQSVGQWA KDMYKVYEFI KHELVKADIN KDIKIIDDIL PIVEQIRDTW HEVYNKL          117
//

If you have problems or comments...

PBIL Back to PBIL home page