(data stored in ACNUC9435 zone)

EMBL: AM180355.FLIZ

AM180355.FLIZ        Location/Qualifiers
FT   CDS             320569..320943
FT                   /transl_table=11
FT                   /gene="fliZ"
FT                   /locus_tag="CD630_02590"
FT                   /old_locus_tag="CD0259"
FT                   /product="Flagellar protein FliZ"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67081"
FT                   /db_xref="GOA:Q18D02"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D02"
FT                   /protein_id="CAJ67081.1"
FT                   /translation="MILYLLKILICIPIILILIVLSLKISQGTLLKKYNDKYVKILDIV
FT                   NISKNNSIIILKIGEEGCIMASSSSSMSKIKDLTKEEILKIENDIKERNFKIQDFKMEK
FT                   IKKKYDFSRYIGKFTKKEDK"
     MILYLLKILI CIPIILILIV LSLKISQGTL LKKYNDKYVK ILDIVNISKN NSIIILKIGE        60
     EGCIMASSSS SMSKIKDLTK EEILKIENDI KERNFKIQDF KMEKIKKKYD FSRYIGKFTK       120
     KEDK                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page