(data stored in ACNUC9435 zone)

EMBL: AM180355.NRDG

AM180355.NRDG        Location/Qualifiers
FT   CDS             140393..140932
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="CD630_01090"
FT                   /old_locus_tag="CD0109"
FT                   /product="Anaerobic ribonucleoside-triphosphate
FT                   reductase-activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66928"
FT                   /db_xref="GOA:Q18CJ8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CJ8"
FT                   /protein_id="CAJ66928.1"
FT                   /translation="MKIRMSSTISYDSIVDGPGLRMVIWTQGCIHNCKECHNPQTHDLC
FT                   GGFYMDTEEIINKVKSLKLQKGITLSGGEPFLQPEPLEEIAREAKINGLDVWSYTGFTF
FT                   EQLLDKKNRAYFKNLNLLKQIDILVDGKFIAEKKDISLKFRGSSNQRIIDVQKSLKYKK
FT                   VFLVEQYMKDDLSIAE"
     MKIRMSSTIS YDSIVDGPGL RMVIWTQGCI HNCKECHNPQ THDLCGGFYM DTEEIINKVK        60
     SLKLQKGITL SGGEPFLQPE PLEEIAREAK INGLDVWSYT GFTFEQLLDK KNRAYFKNLN       120
     LLKQIDILVD GKFIAEKKDI SLKFRGSSNQ RIIDVQKSLK YKKVFLVEQY MKDDLSIAE        179
//

If you have problems or comments...

PBIL Back to PBIL home page