(data stored in ACNUC9435 zone)

EMBL: AM180355.PE118

AM180355.PE118       Location/Qualifiers
FT   CDS             154769..155950
FT                   /transl_table=11
FT                   /locus_tag="CD630_01110"
FT                   /old_locus_tag="CD0111"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66930"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CJ9"
FT                   /protein_id="CAJ66930.1"
FT                   /translation="MINRLKNNTKIKIISFLSAIALWMYVMAVVDPEETKGFEDIPVSI
FT                   SNMSDLKDKNLVIYPDEKLTADVYIKGSLSKVQSVKKEDIHVYGTIEDPIQGQKEVYLK
FT                   ANIPQGVTLEFKHDVLVVNLEKNIKEKRDIKVEVSGNSKRNINKIELSKEFVDVSGPRT
FT                   LVKEVKSVRANLDVGNETDDFSKKLQLIPLNSDGTKVEGVTLSSSFVTAKIELLKEKIV
FT                   PIRVSLNDNKDNDVLKNYKLSKEQVTIKGKKEDIDKISYIKTKPIDLADLANGEEKEVS
FT                   LEIPEGITLEDSSITIKLNDTKQLSAEFLYNAGDIELRNIPTNMDNPNVISDVDIKVVV
FT                   ESTEDLSKLNKKDISLYIDLSQGPEEDSKYKIKYETTYQFKKINIEPNIVEVE"
     MINRLKNNTK IKIISFLSAI ALWMYVMAVV DPEETKGFED IPVSISNMSD LKDKNLVIYP        60
     DEKLTADVYI KGSLSKVQSV KKEDIHVYGT IEDPIQGQKE VYLKANIPQG VTLEFKHDVL       120
     VVNLEKNIKE KRDIKVEVSG NSKRNINKIE LSKEFVDVSG PRTLVKEVKS VRANLDVGNE       180
     TDDFSKKLQL IPLNSDGTKV EGVTLSSSFV TAKIELLKEK IVPIRVSLND NKDNDVLKNY       240
     KLSKEQVTIK GKKEDIDKIS YIKTKPIDLA DLANGEEKEV SLEIPEGITL EDSSITIKLN       300
     DTKQLSAEFL YNAGDIELRN IPTNMDNPNV ISDVDIKVVV ESTEDLSKLN KKDISLYIDL       360
     SQGPEEDSKY KIKYETTYQF KKINIEPNIV EVE                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page