(data stored in ACNUC9435 zone)

EMBL: AM180355.PE125

AM180355.PE125       Location/Qualifiers
FT   CDS             160290..161042
FT                   /transl_table=11
FT                   /locus_tag="CD630_01170"
FT                   /old_locus_tag="CD0117"
FT                   /product="putative ferredoxin/flavodoxin
FT                   oxidoreductase,beta subunit"
FT                   /EC_number="1.2.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66937"
FT                   /db_xref="GOA:Q18CK7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CK7"
FT                   /protein_id="CAJ66937.1"
FT                   /translation="MAVVFKKTEGLQDTQTHYCPGCTHGIIHRLVGEVLEELGVLGDAV
FT                   GVVPVGCSVLGYKYFNCDTQEAAHGRAPAAATGIKRVHPENTVFTYQGDGDLASIGTAE
FT                   IVHAAARGEKITTIFVNNTTYGMTGGQMAPTTLVGQRATTAQSGRNAETQGYPIRVSEM
FT                   LATLTGAVFVERVAVDTPAHVRQAKKAIKKAFQVQQAGLGFGIVEVLSTCPTNWGLAPN
FT                   DALQWLRDNMIPYYPLGNFKNVEVEEVK"
     MAVVFKKTEG LQDTQTHYCP GCTHGIIHRL VGEVLEELGV LGDAVGVVPV GCSVLGYKYF        60
     NCDTQEAAHG RAPAAATGIK RVHPENTVFT YQGDGDLASI GTAEIVHAAA RGEKITTIFV       120
     NNTTYGMTGG QMAPTTLVGQ RATTAQSGRN AETQGYPIRV SEMLATLTGA VFVERVAVDT       180
     PAHVRQAKKA IKKAFQVQQA GLGFGIVEVL STCPTNWGLA PNDALQWLRD NMIPYYPLGN       240
     FKNVEVEEVK                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page