(data stored in ACNUC9435 zone)

EMBL: AM180355.PE126

AM180355.PE126       Location/Qualifiers
FT   CDS             161043..161600
FT                   /transl_table=11
FT                   /locus_tag="CD630_01180"
FT                   /old_locus_tag="CD0118"
FT                   /product="putative ferredoxin/flavodoxin
FT                   oxidoreductase,gamma subunit"
FT                   /EC_number="1.2.7.-"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66938"
FT                   /db_xref="GOA:Q18CK6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CK6"
FT                   /protein_id="CAJ66938.1"
FT                   /translation="MSTARVICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMR
FT                   GGTANCAVTVSNEPVGSPLITDDATAAILLNIPAFEKFKDDVIPGGKIIVNSSLIKEKV
FT                   DRTDVDVYYIPANELAAELGNDKVANMIMLGAYLKVSDTVDIESVLEAFKKVFGPRKEK
FT                   FVPLNREALQKGMDATCSKATN"
     MSTARVICAG FGGQGVMSMG QLLTYAGMLE GKEVSWLPSY GPEMRGGTAN CAVTVSNEPV        60
     GSPLITDDAT AAILLNIPAF EKFKDDVIPG GKIIVNSSLI KEKVDRTDVD VYYIPANELA       120
     AELGNDKVAN MIMLGAYLKV SDTVDIESVL EAFKKVFGPR KEKFVPLNRE ALQKGMDATC       180
     SKATN                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page