(data stored in ACNUC9435 zone)

EMBL: AM180355.PE150

AM180355.PE150       Location/Qualifiers
FT   CDS             188593..189144
FT                   /transl_table=11
FT                   /locus_tag="CD630_01420"
FT                   /old_locus_tag="CD0142"
FT                   /product="putative RNA-binding protein"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: down-regulated in Spo0A
FT                   mutant PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66962"
FT                   /db_xref="GOA:Q18CN1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CN1"
FT                   /protein_id="CAJ66962.1"
FT                   /translation="MNIIISGKQIELTDAIKNKIETKLSKLDNYIHPDTDVKVTVSARK
FT                   ARQKIEVTIATVNGPIIRAEDMQENLYTAIDVVYDKLSKQLKKYKKRLQDKHKDNKSIR
FT                   FQDAEINLADEQEDYGDENQELVIQRRKKFSVKPMSEEEAVLQMELIGHDFYMFKNIDS
FT                   DEIAVVYKRNNGGYGIIEHE"
     MNIIISGKQI ELTDAIKNKI ETKLSKLDNY IHPDTDVKVT VSARKARQKI EVTIATVNGP        60
     IIRAEDMQEN LYTAIDVVYD KLSKQLKKYK KRLQDKHKDN KSIRFQDAEI NLADEQEDYG       120
     DENQELVIQR RKKFSVKPMS EEEAVLQMEL IGHDFYMFKN IDSDEIAVVY KRNNGGYGII       180
     EHE                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page