(data stored in ACNUC9435 zone)

EMBL: AM180355.PE173

AM180355.PE173       Location/Qualifiers
FT   CDS             217381..217674
FT                   /transl_table=11
FT                   /locus_tag="CD630_01640"
FT                   /old_locus_tag="CD0164"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66985"
FT                   /db_xref="GOA:Q18CQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CQ2"
FT                   /protein_id="CAJ66985.1"
FT                   /translation="MISMIMMLIGVLFIVFGIILTAVEIKGKMPGFYGVGQNAVRKNAI
FT                   GIIAAGIALIFFRNGLDSIDSILTYGVFLVIELVVIGLYFLIRIKYDKDGNL"
     MISMIMMLIG VLFIVFGIIL TAVEIKGKMP GFYGVGQNAV RKNAIGIIAA GIALIFFRNG        60
     LDSIDSILTY GVFLVIELVV IGLYFLIRIK YDKDGNL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page