(data stored in ACNUC9435 zone)

EMBL: AM180355.PE177

AM180355.PE177       Location/Qualifiers
FT   CDS             223261..223914
FT                   /transl_table=11
FT                   /locus_tag="CD630_01680"
FT                   /old_locus_tag="CD0168"
FT                   /product="putative cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66989"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CQ6"
FT                   /protein_id="CAJ66989.1"
FT                   /translation="MMKAEKTSIYPIIKNNLNKISIVEYKKGQRFVASDKDLQEVFFII
FT                   EGVALVECTTRGGNKFLVDIVPENEFIGKISYIYEHNLKCDIFAKTNIKLFRFEKNVFE
FT                   EFYLKPDFIALFHRKCTRRIYELYKTRMVRELFSCTEVIAYCISNKQENNVCNIKAIRN
FT                   FSEIYSISRKSRYHSLLKLTEKEIVKKMGNTYEILNYDELHKLAFEVKEFLEDE"
     MMKAEKTSIY PIIKNNLNKI SIVEYKKGQR FVASDKDLQE VFFIIEGVAL VECTTRGGNK        60
     FLVDIVPENE FIGKISYIYE HNLKCDIFAK TNIKLFRFEK NVFEEFYLKP DFIALFHRKC       120
     TRRIYELYKT RMVRELFSCT EVIAYCISNK QENNVCNIKA IRNFSEIYSI SRKSRYHSLL       180
     KLTEKEIVKK MGNTYEILNY DELHKLAFEV KEFLEDE                                217
//

If you have problems or comments...

PBIL Back to PBIL home page