(data stored in ACNUC9435 zone)

EMBL: AM180355.PE192

AM180355.PE192       Location/Qualifiers
FT   CDS             240359..240475
FT                   /transl_table=11
FT                   /locus_tag="CD630_01811"
FT                   /old_locus_tag="CD0181A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01811"
FT                   /db_xref="EnsemblGenomes-Tr:CCA62786"
FT                   /db_xref="UniProtKB/TrEMBL:F3Y619"
FT                   /protein_id="CCA62786.1"
FT                   /translation="MNSNLLRNKYILIKIDTYIPRIKNSQDSTQGYTYKELK"
     MNSNLLRNKY ILIKIDTYIP RIKNSQDSTQ GYTYKELK                                38
//

If you have problems or comments...

PBIL Back to PBIL home page