(data stored in ACNUC9435 zone)

EMBL: AM180355.PE209

AM180355.PE209       Location/Qualifiers
FT   CDS             258083..258208
FT                   /transl_table=11
FT                   /locus_tag="CD630_01981"
FT                   /old_locus_tag="CD0198A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_01981"
FT                   /db_xref="EnsemblGenomes-Tr:CCA62787"
FT                   /db_xref="UniProtKB/TrEMBL:F3Y620"
FT                   /protein_id="CCA62787.1"
FT                   /translation="MPKIHINTGFKVSLTSMLYWFDTYQYLPVSYGLISKKHPAE"
     MPKIHINTGF KVSLTSMLYW FDTYQYLPVS YGLISKKHPA E                            41
//

If you have problems or comments...

PBIL Back to PBIL home page