(data stored in ACNUC9435 zone)

EMBL: AM180355.PE214

AM180355.PE214       Location/Qualifiers
FT   CDS             complement(262205..265633)
FT                   /transl_table=11
FT                   /locus_tag="CD630_02030"
FT                   /old_locus_tag="CD0203"
FT                   /product="putative UvrABC system protein A 1 (UvrA protein
FT                   1) (Excinuclease ABC subunit A 1)"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67024"
FT                   /db_xref="GOA:Q18CU1"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CU1"
FT                   /protein_id="CAJ67024.1"
FT                   /translation="MKINNYKNQSIITNPKKFENKYQDLPKTPIELLKVVQSLVIHGDQ
FT                   GKLYGISFNKQQSDEELLRTIPQMLKRIFEINSNPLTIPRNPKQRLVGMCRDYSLLLVS
FT                   LLRYRGFEARMRAGFANYFESELTYEDHWLVEYYDTLKKRWIRIDAQIDDIQKNYFQIN
FT                   FDTHDVGKTDGFLTGSEAWIRCQQGHAHPDDFGYNKNWKGWHSVKGNLLHDFNNMIGLE
FT                   LLPWDLWTELSSKKYNQLTRAEKNLLDEMAEILSSGNIKIEDLNLLIEKLPEDYLKSIF
FT                   SQLKILGISEIKELGNPLELEKKFKFTKSINKSIKNSLCHNKSSIYLKGGRQNNLKDVE
FT                   VTIPKNQITVITGVSGSGKSSLAFDTIYEEGKRRYFENLSNGAKLSEQLQKPEFDLLQG
FT                   LTPTIAIEQKKGSQNPRSTVGTLTSIWDYLRMLFVSIGKSYCPYCKIPLEKKNNTKNYC
FT                   PHCQTIFSKINTSTFNANSHTGACHDCNGLGFTYQVNPQLIVKDPTISILDGATYYFGK
FT                   LRGKKPNGNWMVGELYAIAKDKNIDLDIPWNELPRDFIDAILYGTDDKIYEFSFESKGR
FT                   ESKIRRPASGAINHIQRLFRESSSENNTLHQYMNKIPCNTCGGELLCIEARFTTIKGYR
FT                   FPELTKMTIEQLWNWLCELPNQLQKNELSLVNDILTELKIRVSYLLKVGLSYISTDRTA
FT                   PTLSGGELQRVRLSSQLGSELVGLTYILDEPSIGLHPRDHNLIIKMIEELRDKGNTVIV
FT                   VEHDKDTILSADYIIDVGPSAGTKGGFIIAEGTTQEIIKNPNSITGKYLSTYNKTGSQN
FT                   KTIPSKWLSLKGCHANNLKNIDVEIPLNCMCSITGVSGSGKSSLVFHSLLPALEEKLKQ
FT                   KSIPDKNYTEFTGFDAIDDFILMDQTPIGKSSRSTPATYINIFDEIRSLFAETPQAKQK
FT                   LLDESYFSFNSKKGQCPNCQGLGKTKIILQYMADQWVTCSECQGKRYQKEILSIQYKGK
FT                   TIADILDMEVAEAKTFFSDCSDIYRKLSLLDEVGLGYLKLGQNTLGLSGGESQRIKLAK
FT                   ELGTKTKKRMLYILDEPTTGLHFKDIENLLITFRKLVNEQHSLLIIEHNTEVIRASDWI
FT                   IDIGPDSGINGGEIVASGTPDEIKINPNSITGHFI"
     MKINNYKNQS IITNPKKFEN KYQDLPKTPI ELLKVVQSLV IHGDQGKLYG ISFNKQQSDE        60
     ELLRTIPQML KRIFEINSNP LTIPRNPKQR LVGMCRDYSL LLVSLLRYRG FEARMRAGFA       120
     NYFESELTYE DHWLVEYYDT LKKRWIRIDA QIDDIQKNYF QINFDTHDVG KTDGFLTGSE       180
     AWIRCQQGHA HPDDFGYNKN WKGWHSVKGN LLHDFNNMIG LELLPWDLWT ELSSKKYNQL       240
     TRAEKNLLDE MAEILSSGNI KIEDLNLLIE KLPEDYLKSI FSQLKILGIS EIKELGNPLE       300
     LEKKFKFTKS INKSIKNSLC HNKSSIYLKG GRQNNLKDVE VTIPKNQITV ITGVSGSGKS       360
     SLAFDTIYEE GKRRYFENLS NGAKLSEQLQ KPEFDLLQGL TPTIAIEQKK GSQNPRSTVG       420
     TLTSIWDYLR MLFVSIGKSY CPYCKIPLEK KNNTKNYCPH CQTIFSKINT STFNANSHTG       480
     ACHDCNGLGF TYQVNPQLIV KDPTISILDG ATYYFGKLRG KKPNGNWMVG ELYAIAKDKN       540
     IDLDIPWNEL PRDFIDAILY GTDDKIYEFS FESKGRESKI RRPASGAINH IQRLFRESSS       600
     ENNTLHQYMN KIPCNTCGGE LLCIEARFTT IKGYRFPELT KMTIEQLWNW LCELPNQLQK       660
     NELSLVNDIL TELKIRVSYL LKVGLSYIST DRTAPTLSGG ELQRVRLSSQ LGSELVGLTY       720
     ILDEPSIGLH PRDHNLIIKM IEELRDKGNT VIVVEHDKDT ILSADYIIDV GPSAGTKGGF       780
     IIAEGTTQEI IKNPNSITGK YLSTYNKTGS QNKTIPSKWL SLKGCHANNL KNIDVEIPLN       840
     CMCSITGVSG SGKSSLVFHS LLPALEEKLK QKSIPDKNYT EFTGFDAIDD FILMDQTPIG       900
     KSSRSTPATY INIFDEIRSL FAETPQAKQK LLDESYFSFN SKKGQCPNCQ GLGKTKIILQ       960
     YMADQWVTCS ECQGKRYQKE ILSIQYKGKT IADILDMEVA EAKTFFSDCS DIYRKLSLLD      1020
     EVGLGYLKLG QNTLGLSGGE SQRIKLAKEL GTKTKKRMLY ILDEPTTGLH FKDIENLLIT      1080
     FRKLVNEQHS LLIIEHNTEV IRASDWIIDI GPDSGINGGE IVASGTPDEI KINPNSITGH      1140
     FI                                                                     1142
//

If you have problems or comments...

PBIL Back to PBIL home page