(data stored in ACNUC9435 zone)

EMBL: AM180355.PE249

AM180355.PE249       Location/Qualifiers
FT   CDS             300506..300841
FT                   /transl_table=11
FT                   /locus_tag="CD630_02380"
FT                   /old_locus_tag="CD0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67059"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CX8"
FT                   /protein_id="CAJ67059.1"
FT                   /translation="MDKLEEKINLYKDISLKIINFIEKMEYKNISFQLDERQNIIDSIS
FT                   EVDKSEFIQLYDSMELFEIDAKIRDALQEQLSEVKKELHEYKLTKQVNTMYYSSNREKV
FT                   NIFNKKV"
     MDKLEEKINL YKDISLKIIN FIEKMEYKNI SFQLDERQNI IDSISEVDKS EFIQLYDSME        60
     LFEIDAKIRD ALQEQLSEVK KELHEYKLTK QVNTMYYSSN REKVNIFNKK V                111
//

If you have problems or comments...

PBIL Back to PBIL home page