(data stored in ACNUC9435 zone)

EMBL: AM180355.PE253

AM180355.PE253       Location/Qualifiers
FT   CDS             305341..305985
FT                   /transl_table=11
FT                   /locus_tag="CD630_02420"
FT                   /old_locus_tag="CD0242"
FT                   /product="putative nucleoside triphosphate transferase"
FT                   /note="Part of flagella glycosylation cluster
FT                   PMID:19749038. Experimentally verified through RNA-seq as
FT                   part of Spo0A regulated transcriptome: up-regulated in
FT                   Spo0A mutant . Experimentally verified through Mass
FT                   Spectrometry as part of Spo0A regulated proteome:
FT                   up-regulated in Spo0A mutant PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67063"
FT                   /db_xref="GOA:Q18CY2"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CY2"
FT                   /protein_id="CAJ67063.1"
FT                   /translation="MPTTKTIVVNCAGRGSRLGLNSNKSLIDIDGKPLIIRQLECLDDY
FT                   DDIRIVVGFQAEKLIEVVCSYRKDIMFVFNHDYLNTKTAASLSLGKKYSRDTVISLDGD
FT                   ILFFKEDFDNFVNTDGEIIGVCQPYTKDPVYVKTDFINDGEFATEFSRTNGDYEWTGLF
FT                   KIYSKNLSSGTNHVYKMISPNLPLKIAHVELREIDTPEEYNEALKWYRNKK"
     MPTTKTIVVN CAGRGSRLGL NSNKSLIDID GKPLIIRQLE CLDDYDDIRI VVGFQAEKLI        60
     EVVCSYRKDI MFVFNHDYLN TKTAASLSLG KKYSRDTVIS LDGDILFFKE DFDNFVNTDG       120
     EIIGVCQPYT KDPVYVKTDF INDGEFATEF SRTNGDYEWT GLFKIYSKNL SSGTNHVYKM       180
     ISPNLPLKIA HVELREIDTP EEYNEALKWY RNKK                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page