(data stored in ACNUC9435 zone)

EMBL: AM180355.PE279

AM180355.PE279       Location/Qualifiers
FT   CDS             328398..328820
FT                   /transl_table=11
FT                   /locus_tag="CD630_02670"
FT                   /old_locus_tag="CD0267"
FT                   /product="putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67089"
FT                   /db_xref="GOA:Q18D06"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D06"
FT                   /protein_id="CAJ67089.1"
FT                   /translation="MIQIILIVVSILIIVTIVINLHKESKNKDNRYFDKIFEQEYEAND
FT                   RLIIAEKRRFFLDKVLAEKRSNSHIKVYENYNLIKANEERKENIFIESKKEVRQENELS
FT                   LKVKHLISSGYDDVEICKMLDIGKGELLLIRSCYKI"
     MIQIILIVVS ILIIVTIVIN LHKESKNKDN RYFDKIFEQE YEANDRLIIA EKRRFFLDKV        60
     LAEKRSNSHI KVYENYNLIK ANEERKENIF IESKKEVRQE NELSLKVKHL ISSGYDDVEI       120
     CKMLDIGKGE LLLIRSCYKI                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page