(data stored in ACNUC9435 zone)

EMBL: AM180355.PE291

AM180355.PE291       Location/Qualifiers
FT   CDS             339229..339645
FT                   /transl_table=11
FT                   /locus_tag="CD630_02770"
FT                   /old_locus_tag="CD0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67099"
FT                   /db_xref="InterPro:IPR024265"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D15"
FT                   /protein_id="CAJ67099.1"
FT                   /translation="MNWQDAFFQDTKPTFEQINEFINNPLWDKLNKTLVSTYNVEPKLE
FT                   YSKCSMQRGWNVKYKKRGKSLCTLYPQEGYFKALVIVSESNRVEVDLFINTCCDYIKKI
FT                   YNEVNFFNGSKWLMIQVDSLLVLNDMLELIKFRA"
     MNWQDAFFQD TKPTFEQINE FINNPLWDKL NKTLVSTYNV EPKLEYSKCS MQRGWNVKYK        60
     KRGKSLCTLY PQEGYFKALV IVSESNRVEV DLFINTCCDY IKKIYNEVNF FNGSKWLMIQ       120
     VDSLLVLNDM LELIKFRA                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page