(data stored in ACNUC9435 zone)

EMBL: AM180355.PE30

AM180355.PE30        Location/Qualifiers
FT   CDS             48076..49170
FT                   /transl_table=11
FT                   /locus_tag="CD630_00290"
FT                   /old_locus_tag="CD0029"
FT                   /product="putative membrane protein"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66843"
FT                   /db_xref="GOA:Q18CB1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CB1"
FT                   /protein_id="CAJ66843.1"
FT                   /translation="MIRKVTRILFILLGFTIGITTYLTLMKDFEILTFGKETYGYIAAV
FT                   VAGIIIAILGYLIEPWVVNKVKEIAKIVDKELSKYPQTDILLGSMGLIVGFVIAYLLSG
FT                   LVNRIPIVGGILSLLLYLFLGYLGMKVALKSKNDLFNVGKLGRLANPIKDKDKDKENKK
FT                   EVKAIPPKVLDTSVIIDGRIADICKTGFIEGKLIIPAFVLEELRHIADSSDDLKRVRGR
FT                   RGLDILNIIQKELNIEVEISERDFDDIAEVDSKLLKLAQVLNGKVVTNDYNLNKVAQFQ
FT                   GVEVLNINELANAIKPVAIPGEDMVVQVVKEGKEAQQGVAYLDDGTMIVVDGGRKYMNE
FT                   TIKVLVTSVLQTPAGRMIFAKPKN"
     MIRKVTRILF ILLGFTIGIT TYLTLMKDFE ILTFGKETYG YIAAVVAGII IAILGYLIEP        60
     WVVNKVKEIA KIVDKELSKY PQTDILLGSM GLIVGFVIAY LLSGLVNRIP IVGGILSLLL       120
     YLFLGYLGMK VALKSKNDLF NVGKLGRLAN PIKDKDKDKE NKKEVKAIPP KVLDTSVIID       180
     GRIADICKTG FIEGKLIIPA FVLEELRHIA DSSDDLKRVR GRRGLDILNI IQKELNIEVE       240
     ISERDFDDIA EVDSKLLKLA QVLNGKVVTN DYNLNKVAQF QGVEVLNINE LANAIKPVAI       300
     PGEDMVVQVV KEGKEAQQGV AYLDDGTMIV VDGGRKYMNE TIKVLVTSVL QTPAGRMIFA       360
     KPKN                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page