(data stored in ACNUC9435 zone)

EMBL: AM180355.PE308

AM180355.PE308       Location/Qualifiers
FT   CDS             354353..355270
FT                   /transl_table=11
FT                   /locus_tag="CD630_02930"
FT                   /old_locus_tag="CD0293"
FT                   /product="ABC-type transport
FT                   system,bacitracin/multidrug-family ATP-binding protein"
FT                   /EC_number="3.6.3.30"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67115"
FT                   /db_xref="GOA:Q18D31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D31"
FT                   /protein_id="CAJ67115.2"
FT                   /translation="MNIVSINGLSKGFGNRKIIDNLNFTVPEGSVFGFVGKNGAGKTTT
FT                   MKMVLGLLEPDSGTIDVCGEKVTYGRTSSNRHVGYLPDVPEFYNYMRPLEYLSLCGEIT
FT                   GLSKKEIQIRSEELLSLVGLGNEKRRIGGFSRGMKQRLGIAQALLSRPKLLICDEPTSA
FT                   LDPVGRKEILDIMLKIKDSTTVIFSTHILSDVERICDHVAILNKGSIALSGTLSEIKSM
FT                   HGKDRLLLEFASNDEIQKFKSSDGIKSLLKDSEETNMEIVLHGKDIKAIQKTVISTLAE
FT                   MNLCPVKMELIELSLENLFLEVVK"
     MNIVSINGLS KGFGNRKIID NLNFTVPEGS VFGFVGKNGA GKTTTMKMVL GLLEPDSGTI        60
     DVCGEKVTYG RTSSNRHVGY LPDVPEFYNY MRPLEYLSLC GEITGLSKKE IQIRSEELLS       120
     LVGLGNEKRR IGGFSRGMKQ RLGIAQALLS RPKLLICDEP TSALDPVGRK EILDIMLKIK       180
     DSTTVIFSTH ILSDVERICD HVAILNKGSI ALSGTLSEIK SMHGKDRLLL EFASNDEIQK       240
     FKSSDGIKSL LKDSEETNME IVLHGKDIKA IQKTVISTLA EMNLCPVKME LIELSLENLF       300
     LEVVK                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page