(data stored in ACNUC9435 zone)

EMBL: AM180355.PE310

AM180355.PE310       Location/Qualifiers
FT   CDS             356273..357346
FT                   /transl_table=11
FT                   /locus_tag="CD630_02950"
FT                   /old_locus_tag="CD0295"
FT                   /product="putative iron-sulfur-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67117"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D37"
FT                   /protein_id="CAJ67117.1"
FT                   /translation="MEKSKVYFCDLYSNSQNKNVPNNVRRLFDEAGFKDLIEKNDQVAI
FT                   KLHFGEKGNTTYMSPVAVRQVVDKVKDCEGKPFLTDTNTLYTGSRTNSVDHLTTAIENG
FT                   FAYAVVNAPVIIADGLYSRNYENVKIDKKHFESVKIGGEIYNSSAMIVMSHFKGHEAAG
FT                   FGGALKNLAMGCASAAGKQMQHSDVTPVVKEKKCVGCGKCVNSCPTKAISIVDKKAVID
FT                   SDVCYGCGECPTVCPTRAVTIQWESDSDVFVEKMAEYAYGAVSNKKDKVGYITFVMNVT
FT                   PLCDCVPWSGRPIAHDIGILASTDPVAIEQACYDLICKEMGHDVFKHEHPHVNGTRIID
FT                   YACEMGMGSKEYELIKL"
     MEKSKVYFCD LYSNSQNKNV PNNVRRLFDE AGFKDLIEKN DQVAIKLHFG EKGNTTYMSP        60
     VAVRQVVDKV KDCEGKPFLT DTNTLYTGSR TNSVDHLTTA IENGFAYAVV NAPVIIADGL       120
     YSRNYENVKI DKKHFESVKI GGEIYNSSAM IVMSHFKGHE AAGFGGALKN LAMGCASAAG       180
     KQMQHSDVTP VVKEKKCVGC GKCVNSCPTK AISIVDKKAV IDSDVCYGCG ECPTVCPTRA       240
     VTIQWESDSD VFVEKMAEYA YGAVSNKKDK VGYITFVMNV TPLCDCVPWS GRPIAHDIGI       300
     LASTDPVAIE QACYDLICKE MGHDVFKHEH PHVNGTRIID YACEMGMGSK EYELIKL          357
//

If you have problems or comments...

PBIL Back to PBIL home page