(data stored in ACNUC9435 zone)

EMBL: AM180355.PE321

AM180355.PE321       Location/Qualifiers
FT   CDS             368579..369418
FT                   /transl_table=11
FT                   /locus_tag="CD630_03060"
FT                   /old_locus_tag="CD0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67128"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D44"
FT                   /protein_id="CAJ67128.1"
FT                   /translation="MFGYVKINKMDLTFREYDYYKAYYCGLCKYLKRNHGEISRFSLNY
FT                   DITFLIVLLTAVYNPESISTEEVCIVNPFKKKKVITNDITEYAASMNILLTYYKLEDNL
FT                   MDDKRIKDKLAYYIYKNKLKLAYEKYPEKAEYIKQQLNELNKLEKDKNINIDEVSSIFG
FT                   NIMGEVFVYKKDENERNLRMIGFNIGKYIYLLDAYEDLDEDFKKGRYNPFIEYIDKNDE
FT                   LKEKVKKIIVTSLGFLARGIDNLNLNKNVGIIENIIYSGVYLRYINILESRGGKNVQ"
     MFGYVKINKM DLTFREYDYY KAYYCGLCKY LKRNHGEISR FSLNYDITFL IVLLTAVYNP        60
     ESISTEEVCI VNPFKKKKVI TNDITEYAAS MNILLTYYKL EDNLMDDKRI KDKLAYYIYK       120
     NKLKLAYEKY PEKAEYIKQQ LNELNKLEKD KNINIDEVSS IFGNIMGEVF VYKKDENERN       180
     LRMIGFNIGK YIYLLDAYED LDEDFKKGRY NPFIEYIDKN DELKEKVKKI IVTSLGFLAR       240
     GIDNLNLNKN VGIIENIIYS GVYLRYINIL ESRGGKNVQ                              279
//

If you have problems or comments...

PBIL Back to PBIL home page