(data stored in ACNUC9435 zone)

EMBL: AM180355.PE326

AM180355.PE326       Location/Qualifiers
FT   CDS             complement(372933..373781)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03110"
FT                   /old_locus_tag="CD0311"
FT                   /product="putative spore coat assembly asparagine-rich
FT                   protein"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: down-regulated in Spo0A
FT                   mutant PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67133"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D54"
FT                   /protein_id="CAJ67133.1"
FT                   /translation="MSNKKKKDLDTSYMPYLDPANYADYITNEEIPQDELRNDPQISNG
FT                   YTKIPNNQNINNLYPNNVNHYPKSSNSPNNLPNTNNTSGNMNYNTSATNNMPNNMNNNT
FT                   GMPNNMSNNMNSNMGMPNNMSNNMNSNMGMPNNMPNNMNSNMGMPNNVPNNMNSNMGMP
FT                   NNMSNNMNSNMGMPNNMSGNMNNNMYGNTGMPNNMNSNMGYNMNNTMGIPNFSCNQNMP
FT                   PNVLMMIPGVICHNTMQGMPVVMPSTMPPNIYPTPYGSSNMSIQGIPQATNIEEFDEEE
FT                   M"
     MSNKKKKDLD TSYMPYLDPA NYADYITNEE IPQDELRNDP QISNGYTKIP NNQNINNLYP        60
     NNVNHYPKSS NSPNNLPNTN NTSGNMNYNT SATNNMPNNM NNNTGMPNNM SNNMNSNMGM       120
     PNNMSNNMNS NMGMPNNMPN NMNSNMGMPN NVPNNMNSNM GMPNNMSNNM NSNMGMPNNM       180
     SGNMNNNMYG NTGMPNNMNS NMGYNMNNTM GIPNFSCNQN MPPNVLMMIP GVICHNTMQG       240
     MPVVMPSTMP PNIYPTPYGS SNMSIQGIPQ ATNIEEFDEE EM                          282
//

If you have problems or comments...

PBIL Back to PBIL home page