(data stored in ACNUC9435 zone)

EMBL: AM180355.PE334

AM180355.PE334       Location/Qualifiers
FT   CDS             complement(385965..386084)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03181"
FT                   /old_locus_tag="CD0318A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03181"
FT                   /db_xref="EnsemblGenomes-Tr:CCA62791"
FT                   /db_xref="UniProtKB/TrEMBL:F3Y624"
FT                   /protein_id="CCA62791.1"
FT                   /translation="MARFWQGSCFIILIVVDFDVVSTIFCRNKFIKSEEIIYE"
     MARFWQGSCF IILIVVDFDV VSTIFCRNKF IKSEEIIYE                               39
//

If you have problems or comments...

PBIL Back to PBIL home page