(data stored in ACNUC9435 zone)

EMBL: AM180355.PE351

AM180355.PE351       Location/Qualifiers
FT   CDS             complement(407612..407953)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03350"
FT                   /old_locus_tag="CD0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67157"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D76"
FT                   /protein_id="CAJ67157.1"
FT                   /translation="MLLILGNLNLDLDFDYRIIREENDDVDIFIDINYRSLDIDTDGSN
FT                   LFNSRIQFPFVRALILRLNKNNQCMTIHLLRDIDLFSAFANFEVDYTDSIVNIKNQNEK
FT                   VILNKSIKK"
     MLLILGNLNL DLDFDYRIIR EENDDVDIFI DINYRSLDID TDGSNLFNSR IQFPFVRALI        60
     LRLNKNNQCM TIHLLRDIDL FSAFANFEVD YTDSIVNIKN QNEKVILNKS IKK              113
//

If you have problems or comments...

PBIL Back to PBIL home page