(data stored in ACNUC9435 zone)

EMBL: AM180355.PE356

AM180355.PE356       Location/Qualifiers
FT   CDS             complement(413328..418385)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03400"
FT                   /old_locus_tag="CD0340"
FT                   /product="uncharacterised protein"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   . Experimentally verified through Mass Spectrometry as part
FT                   of Spo0A regulated proteome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67162"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D80"
FT                   /protein_id="CAJ67162.1"
FT                   /translation="MLERTRVEKNPKIIENFKNNFTKSSSKQYYDLAKSLWDCIENSSY
FT                   YYREPEDKFLNMIKKYYNCHYYEIKNMDELLSGPLKNALELIFTSEQVEELCQLIKRKM
FT                   DYTYSGGYYRKGYRSNKLVDYFRGIIRFISNYVDLIYYDFSVIDYLTLPNKVLYYDSIM
FT                   SDKIALEIDKGNQKVISALEEVIFGENQTALLTRQMIIGIMKSHSDKCYEMLSKLLLAA
FT                   KQQEGLRQQIVESLDEGTISASIYMLKTILDNNLERFSSVIRALDTWTGLGFSDQKPGI
FT                   IRKCLELSYKSLTDEKFRIESINSNDNLEIYFALWATATYNIYDSYSLIENLLSCQEKY
FT                   KKLVALYFLSHTESTYFKHSIASKNIKGDDLEILAWVITNFYVEGSVGYYYSWQNRKTN
FT                   FDLSNTPIDKDFDARKEQFESLKHTLEILNSKTKSFSGSVFPWTWIEISSHEILKCMMT
FT                   LTAYDMNAQFIDVLMENCHLMSSDLRASLIVNFVNEPKTDRQREFLLECLSDKSVSNRE
FT                   TVLSLLRKLELTDVELDKITNLLSLKTSSIRQTVIKILLEQDDSNLENIASSLIKSSNS
FT                   QKCLGGLEIVNLLKDNTARQELYNKLVLLIEDTDKSKKNTSQVQILIDNLLGKAKNDYC
FT                   KENGFGIYNPENKVQIPEQFDFKDDSNSSSKLNKIISNISLSTREDSVSVATKKEAKKI
FT                   LDTDINKIIKVYEKFDELITENADYEYEVERWSGNVDKVLLGYSTYNLTPIKYKVSNDT
FT                   LDNYPLAELWRETSKKLDLDYKLILDILFYSISTCGYNETEKSWFSSIYSNVLDSKKQN
FT                   KIYTKLEKLKFNGLTRKLLRVLLNEFDHKEIFNYCLEIYYKLRNLLTIEQCKKQRVEFT
FT                   KNYYRQNEYCPALNAPILNYWLDKAHSFIYDDISFTKFFYTTFSNYQLLEYKFPFYTSI
FT                   NVFARAHELGLMTEEQVNREMISGYNASNIIRTLTNPRWAGDTLEKYPWLKDNLKTVTN
FT                   RIIEIESRRGDMPTEVSHLANNIQYFEGINYFVNILVALGKETFQRGYSYGSNYSKKDV
FT                   LSSLLKNCYPTKEDDSKKLKSLLKNTDITELRLIESAMYAPQWVNIIEKYLNWKGLKST
FT                   IWYFHAHINEGFSAQKESEVALFSPISPRSFIDGAFDVDWFLDSYKTIGEERFNILYKS
FT                   AKYITSGGNSHRRAQLYADATLGKLDKDMLMKEIETNRNQDKLRSFSLLPMKKGDLKEA
FT                   TFRYEFIQKFAKESKQFGAQRRESESKACTIALENLARSAGFGDVNRMMWALETEKLNE
FT                   VAHLFKPKDIDGTSIWIDVDENGKASTKVQKGNKSLKSIPKAIAKHPYVLELKSVQKDL
FT                   KSQYSRAKQSLEQAMKNEIVFTVKEIANIYKNPVICPLIKNLVWVCDDNIGYVYNDKSK
FT                   FFICNIEGETYKLTAKNKLKLAHPVHLFESGKWSEFQHDLFSKQIVQPFKQVFREYYRI
FT                   NSDELSEKTISRRYAGHQIQPKKTVALLRNQLWTVDYEEGLQKVFYKENIVAKMFALAD
FT                   WFSPADIEPPTIETVEFFDRKTYKSLELASIPPILFSEVMRDIDLVVSVAHAGGVDPET
FT                   SHSTVEMRIAIAKELLLLLKINNVNFEGSHALIAGNLGEYSVHMGSGIVHKKGMGALNI
FT                   LPIHSQSRGKIFLPFADEDPKTAEIMSKILLLAEDSKIKDPSILSNL"
     MLERTRVEKN PKIIENFKNN FTKSSSKQYY DLAKSLWDCI ENSSYYYREP EDKFLNMIKK        60
     YYNCHYYEIK NMDELLSGPL KNALELIFTS EQVEELCQLI KRKMDYTYSG GYYRKGYRSN       120
     KLVDYFRGII RFISNYVDLI YYDFSVIDYL TLPNKVLYYD SIMSDKIALE IDKGNQKVIS       180
     ALEEVIFGEN QTALLTRQMI IGIMKSHSDK CYEMLSKLLL AAKQQEGLRQ QIVESLDEGT       240
     ISASIYMLKT ILDNNLERFS SVIRALDTWT GLGFSDQKPG IIRKCLELSY KSLTDEKFRI       300
     ESINSNDNLE IYFALWATAT YNIYDSYSLI ENLLSCQEKY KKLVALYFLS HTESTYFKHS       360
     IASKNIKGDD LEILAWVITN FYVEGSVGYY YSWQNRKTNF DLSNTPIDKD FDARKEQFES       420
     LKHTLEILNS KTKSFSGSVF PWTWIEISSH EILKCMMTLT AYDMNAQFID VLMENCHLMS       480
     SDLRASLIVN FVNEPKTDRQ REFLLECLSD KSVSNRETVL SLLRKLELTD VELDKITNLL       540
     SLKTSSIRQT VIKILLEQDD SNLENIASSL IKSSNSQKCL GGLEIVNLLK DNTARQELYN       600
     KLVLLIEDTD KSKKNTSQVQ ILIDNLLGKA KNDYCKENGF GIYNPENKVQ IPEQFDFKDD       660
     SNSSSKLNKI ISNISLSTRE DSVSVATKKE AKKILDTDIN KIIKVYEKFD ELITENADYE       720
     YEVERWSGNV DKVLLGYSTY NLTPIKYKVS NDTLDNYPLA ELWRETSKKL DLDYKLILDI       780
     LFYSISTCGY NETEKSWFSS IYSNVLDSKK QNKIYTKLEK LKFNGLTRKL LRVLLNEFDH       840
     KEIFNYCLEI YYKLRNLLTI EQCKKQRVEF TKNYYRQNEY CPALNAPILN YWLDKAHSFI       900
     YDDISFTKFF YTTFSNYQLL EYKFPFYTSI NVFARAHELG LMTEEQVNRE MISGYNASNI       960
     IRTLTNPRWA GDTLEKYPWL KDNLKTVTNR IIEIESRRGD MPTEVSHLAN NIQYFEGINY      1020
     FVNILVALGK ETFQRGYSYG SNYSKKDVLS SLLKNCYPTK EDDSKKLKSL LKNTDITELR      1080
     LIESAMYAPQ WVNIIEKYLN WKGLKSTIWY FHAHINEGFS AQKESEVALF SPISPRSFID      1140
     GAFDVDWFLD SYKTIGEERF NILYKSAKYI TSGGNSHRRA QLYADATLGK LDKDMLMKEI      1200
     ETNRNQDKLR SFSLLPMKKG DLKEATFRYE FIQKFAKESK QFGAQRRESE SKACTIALEN      1260
     LARSAGFGDV NRMMWALETE KLNEVAHLFK PKDIDGTSIW IDVDENGKAS TKVQKGNKSL      1320
     KSIPKAIAKH PYVLELKSVQ KDLKSQYSRA KQSLEQAMKN EIVFTVKEIA NIYKNPVICP      1380
     LIKNLVWVCD DNIGYVYNDK SKFFICNIEG ETYKLTAKNK LKLAHPVHLF ESGKWSEFQH      1440
     DLFSKQIVQP FKQVFREYYR INSDELSEKT ISRRYAGHQI QPKKTVALLR NQLWTVDYEE      1500
     GLQKVFYKEN IVAKMFALAD WFSPADIEPP TIETVEFFDR KTYKSLELAS IPPILFSEVM      1560
     RDIDLVVSVA HAGGVDPETS HSTVEMRIAI AKELLLLLKI NNVNFEGSHA LIAGNLGEYS      1620
     VHMGSGIVHK KGMGALNILP IHSQSRGKIF LPFADEDPKT AEIMSKILLL AEDSKIKDPS      1680
     ILSNL                                                                  1685
//

If you have problems or comments...

PBIL Back to PBIL home page