(data stored in ACNUC9435 zone)

EMBL: AM180355.PE370

AM180355.PE370       Location/Qualifiers
FT   CDS             428111..428677
FT                   /transl_table=11
FT                   /locus_tag="CD630_03541"
FT                   /old_locus_tag="CD0354A"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03541"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67176"
FT                   /db_xref="GOA:Q18D96"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D96"
FT                   /protein_id="CAJ67176.1"
FT                   /translation="MLLAFERVVVRLLGDEEGDIYKNIASSFLFFFIGGVCLLPFSIMD
FT                   RVSDWSFLIPCYISSLVYSIGSVAYVTSLATGEVSLVTPINSLNSLFLLLLSVIFLGEG
FT                   LSLAKVAGIIIMIGGVFILKKVSSFLKNVSVIFNNLPCRLMFLYIFLQSVGRVLDKAFF
FT                   VQVSPILYSTILYFFVGLNLFIFSF"
     MLLAFERVVV RLLGDEEGDI YKNIASSFLF FFIGGVCLLP FSIMDRVSDW SFLIPCYISS        60
     LVYSIGSVAY VTSLATGEVS LVTPINSLNS LFLLLLSVIF LGEGLSLAKV AGIIIMIGGV       120
     FILKKVSSFL KNVSVIFNNL PCRLMFLYIF LQSVGRVLDK AFFVQVSPIL YSTILYFFVG       180
     LNLFIFSF                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page