(data stored in ACNUC9435 zone)

EMBL: AM180355.PE379

AM180355.PE379       Location/Qualifiers
FT   CDS             complement(435772..436542)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03640"
FT                   /old_locus_tag="CD0364"
FT                   /product="ABC-type transport system, ATP-binding protein
FT                   Tn916-like, CTn1-Orf9"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67186"
FT                   /db_xref="GOA:Q18DA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DA1"
FT                   /protein_id="CAJ67186.1"
FT                   /translation="MEHILNLEQVKKYYGGNSGNITKAVDGISMYVDKGEFVAIMGASG
FT                   SGKTTLLNCISTIDTVTSGHITVNNQDITKIKDKDFADFRRENLGFIFQDFNLLDTLTI
FT                   EENISLSLIINKQNSADIEKRVHSIADKLGIRDILLKFPYEVSGGQKQRCACARALINE
FT                   PKLILADEPTGALDSKSSRLLLETMSDINNKMQATILMVTHDPFSASFCERILFLKDGK
FT                   IFNEIFRGEKSRKDFFNEILDILTLLGGEVGNVR"
     MEHILNLEQV KKYYGGNSGN ITKAVDGISM YVDKGEFVAI MGASGSGKTT LLNCISTIDT        60
     VTSGHITVNN QDITKIKDKD FADFRRENLG FIFQDFNLLD TLTIEENISL SLIINKQNSA       120
     DIEKRVHSIA DKLGIRDILL KFPYEVSGGQ KQRCACARAL INEPKLILAD EPTGALDSKS       180
     SRLLLETMSD INNKMQATIL MVTHDPFSAS FCERILFLKD GKIFNEIFRG EKSRKDFFNE       240
     ILDILTLLGG EVGNVR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page