(data stored in ACNUC9435 zone)

EMBL: AM180355.PE390

AM180355.PE390       Location/Qualifiers
FT   CDS             complement(447165..447563)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03750"
FT                   /old_locus_tag="CD0375"
FT                   /product="putative conjugative transposon protein
FT                   Tn916-like, CTn1-Orf20"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67197"
FT                   /db_xref="GOA:Q18DB7"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DB7"
FT                   /protein_id="CAJ67197.1"
FT                   /translation="MKKIKSYTGIWNVEKVLYAINDFNLPFPVTFTQITWFVITEFIII
FT                   LFGDIPPLSMIEGAFLKYFGIPVALTWFMSQKTFDGKKPYSFLKSQITYALRPKITYAG
FT                   KAVKLHKQTLNETITAVRSVNYVPDKIY"
     MKKIKSYTGI WNVEKVLYAI NDFNLPFPVT FTQITWFVIT EFIIILFGDI PPLSMIEGAF        60
     LKYFGIPVAL TWFMSQKTFD GKKPYSFLKS QITYALRPKI TYAGKAVKLH KQTLNETITA       120
     VRSVNYVPDK IY                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page