(data stored in ACNUC9435 zone)

EMBL: AM180355.PE393

AM180355.PE393       Location/Qualifiers
FT   CDS             complement(448620..448916)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03780"
FT                   /old_locus_tag="CD0378"
FT                   /product="putative conjugative transposon protein
FT                   Tn916-like, CTn1-Orf23"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CCA62792"
FT                   /db_xref="UniProtKB/TrEMBL:F3Y625"
FT                   /protein_id="CCA62792.1"
FT                   /translation="MNDIFKDMQAKVGCEYISDLPSYKRKVWHEMKRLNPADYEERQLE
FT                   DFSKYVFGMSYQTLKDVMKQQKGREEQCRKQGCWWKREEQLAKKQRRTGSTCR"
     MNDIFKDMQA KVGCEYISDL PSYKRKVWHE MKRLNPADYE ERQLEDFSKY VFGMSYQTLK        60
     DVMKQQKGRE EQCRKQGCWW KREEQLAKKQ RRTGSTCR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page