(data stored in ACNUC9435 zone)

EMBL: AM180355.PE397

AM180355.PE397       Location/Qualifiers
FT   CDS             complement(450811..451209)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03820"
FT                   /old_locus_tag="CD0382"
FT                   /product="putative conjugative transposon protein
FT                   Tn916-like, CTn1-Orf27"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67203"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DC1"
FT                   /protein_id="CAJ67203.2"
FT                   /translation="MEYLQVTTGNRVTGMEMSGVCVNYGDFWNDVKMTADCEFDKDDYS
FT                   PTERYHNRLSKIMENVWNGKDTFPTIFSIRLEKYISLVDYPVRYTFAIVDKEFFKRTYR
FT                   KGEIPEEILKKCLAKDNDCVVFYVGMNR"
     MEYLQVTTGN RVTGMEMSGV CVNYGDFWND VKMTADCEFD KDDYSPTERY HNRLSKIMEN        60
     VWNGKDTFPT IFSIRLEKYI SLVDYPVRYT FAIVDKEFFK RTYRKGEIPE EILKKCLAKD       120
     NDCVVFYVGM NR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page