(data stored in ACNUC9435 zone)

EMBL: AM180355.PE400

AM180355.PE400       Location/Qualifiers
FT   CDS             complement(453006..453332)
FT                   /transl_table=11
FT                   /locus_tag="CD630_03850"
FT                   /old_locus_tag="CD0385"
FT                   /product="putative conjugative transposon protein DUF961
FT                   family Tn916-like, CTn1-Orf30"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67206"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DB8"
FT                   /protein_id="CAJ67206.1"
FT                   /translation="MELKYVVPNMAQTFGNLEFAGENRTEHQRINGRYSPVSRSFNLYS
FT                   DVQRADDIIVTIPAKAGEKHFKPEQRVQLINPKITADGKNVKGRGFTNYILTADDMLPV
FT                   EESK"
     MELKYVVPNM AQTFGNLEFA GENRTEHQRI NGRYSPVSRS FNLYSDVQRA DDIIVTIPAK        60
     AGEKHFKPEQ RVQLINPKIT ADGKNVKGRG FTNYILTADD MLPVEESK                    108
//

If you have problems or comments...

PBIL Back to PBIL home page