(data stored in ACNUC9435 zone)

EMBL: AM180355.PE423

AM180355.PE423       Location/Qualifiers
FT   CDS             480432..480590
FT                   /transl_table=11
FT                   /locus_tag="CD630_04080"
FT                   /old_locus_tag="CD0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67228"
FT                   /db_xref="UniProtKB/TrEMBL:Q188J5"
FT                   /protein_id="CAJ67228.1"
FT                   /translation="MKILHFKQFYKHYVFVEDGEGGRKKVLKNYIDVNVCIDMVCGDTK
FT                   YELGSEE"
     MKILHFKQFY KHYVFVEDGE GGRKKVLKNY IDVNVCIDMV CGDTKYELGS EE                52
//

If you have problems or comments...

PBIL Back to PBIL home page