(data stored in ACNUC9435 zone)

EMBL: AM180355.PE430

AM180355.PE430       Location/Qualifiers
FT   CDS             485020..485331
FT                   /transl_table=11
FT                   /locus_tag="CD630_04130"
FT                   /old_locus_tag="CD0413"
FT                   /product="putative single-strand DNA-binding protein
FT                   Tn1549-like, CTn2-Orf7"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67235"
FT                   /db_xref="GOA:Q188J8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q188J8"
FT                   /protein_id="CAJ67235.1"
FT                   /translation="MKQEMININANLVAEPTFSNFEKDGETVEVANFTLVKKYGKGKEY
FT                   INCAAYGEKAEKAKDFEKGDLIHIFGYFKKREKEGKTYKNFVVKSYNKIEKKEENEEE"
     MKQEMININA NLVAEPTFSN FEKDGETVEV ANFTLVKKYG KGKEYINCAA YGEKAEKAKD        60
     FEKGDLIHIF GYFKKREKEG KTYKNFVVKS YNKIEKKEEN EEE                         103
//

If you have problems or comments...

PBIL Back to PBIL home page