(data stored in ACNUC9435 zone)

EMBL: AM180355.PE434

AM180355.PE434       Location/Qualifiers
FT   CDS             486717..487106
FT                   /transl_table=11
FT                   /locus_tag="CD630_04170"
FT                   /old_locus_tag="CD0417"
FT                   /product="putative conjugative transposon protein
FT                   Tn1549-like, CTn2-Orf11"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67239"
FT                   /db_xref="GOA:Q188K3"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:Q188K3"
FT                   /protein_id="CAJ67239.1"
FT                   /translation="MAYVPIPKDLNRVKTKVAFNLTKRQLIGFTLAGLVGIPVYLFIRK
FT                   FVPNDIAVIFLIVSTLPIFFITLFEKDGLTFEKYFKHIYLHKFYQPKKRVRKEVYLEQE
FT                   KKNSANKTHAKRKGIEKSKAGLKEK"
     MAYVPIPKDL NRVKTKVAFN LTKRQLIGFT LAGLVGIPVY LFIRKFVPND IAVIFLIVST        60
     LPIFFITLFE KDGLTFEKYF KHIYLHKFYQ PKKRVRKEVY LEQEKKNSAN KTHAKRKGIE       120
     KSKAGLKEK                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page