(data stored in ACNUC9435 zone)

EMBL: AM180355.PE453

AM180355.PE453       Location/Qualifiers
FT   CDS             516647..516835
FT                   /transl_table=11
FT                   /locus_tag="CD630_04341"
FT                   /old_locus_tag="CD0434A"
FT                   /product="putative conjugative transposon protein
FT                   Tn1549-like, CTn2-Orf30"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04341"
FT                   /db_xref="EnsemblGenomes-Tr:CCA62794"
FT                   /db_xref="UniProtKB/TrEMBL:F3Y5S9"
FT                   /protein_id="CCA62794.1"
FT                   /translation="MSCNEIVLERECYEDIFAIRDGGRRMNATIYPLKIEHGNKHSPFF
FT                   HNCSTFMFSRALSLPIK"
     MSCNEIVLER ECYEDIFAIR DGGRRMNATI YPLKIEHGNK HSPFFHNCST FMFSRALSLP        60
     IK                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page