(data stored in ACNUC9435 zone)

EMBL: AM180355.PE460

AM180355.PE460       Location/Qualifiers
FT   CDS             520353..521387
FT                   /transl_table=11
FT                   /locus_tag="CD630_04380"
FT                   /old_locus_tag="CD0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67263"
FT                   /db_xref="GOA:Q188M9"
FT                   /db_xref="UniProtKB/TrEMBL:Q188M9"
FT                   /protein_id="CAJ67263.1"
FT                   /translation="MFKKKLIAVAMSITMISVGSFSYAHSGRTDSSGGHRDNKNKSGLG
FT                   SYHYHCGGYPAHLHNNGGCPYTGGGSSSGTATSVNNEEKQKRSVGEKGYNQGYEDGYKG
FT                   NYSSSNYSGDYSDTYESKYSEGYEKGKAKLEEEEKVAKETGYNLGLTGAKSNNTYEKEV
FT                   LKNAYDTGYSTGYNEYKTKKIEEYKAKGIEDSNKDKEKMTFEENIDSEFIDAYNNAYDE
FT                   IQEQLKNDYTTQGFESAIKGERFDTSTIGNVKYANWFKEGYDNGKVKLPKAKESVYNQG
FT                   YNEEDFSIPDEMKSIETKLKGVYDEGLEKREEEKSRNATYGVGAGTAAVVAGVVYKKKK
FT                   RKKI"
     MFKKKLIAVA MSITMISVGS FSYAHSGRTD SSGGHRDNKN KSGLGSYHYH CGGYPAHLHN        60
     NGGCPYTGGG SSSGTATSVN NEEKQKRSVG EKGYNQGYED GYKGNYSSSN YSGDYSDTYE       120
     SKYSEGYEKG KAKLEEEEKV AKETGYNLGL TGAKSNNTYE KEVLKNAYDT GYSTGYNEYK       180
     TKKIEEYKAK GIEDSNKDKE KMTFEENIDS EFIDAYNNAY DEIQEQLKND YTTQGFESAI       240
     KGERFDTSTI GNVKYANWFK EGYDNGKVKL PKAKESVYNQ GYNEEDFSIP DEMKSIETKL       300
     KGVYDEGLEK REEEKSRNAT YGVGAGTAAV VAGVVYKKKK RKKI                        344
//

If you have problems or comments...

PBIL Back to PBIL home page