(data stored in ACNUC9435 zone)

EMBL: AM180355.PE463

AM180355.PE463       Location/Qualifiers
FT   CDS             523268..523408
FT                   /transl_table=11
FT                   /locus_tag="CD630_04401"
FT                   /old_locus_tag="CD0440A"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04401"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67266"
FT                   /db_xref="UniProtKB/TrEMBL:Q188N2"
FT                   /protein_id="CAJ67266.2"
FT                   /translation="MENLMMSIITGVIASYIYDKLKSHSERPTKSGWELNIKFQKSKSS
FT                   K"
     MENLMMSIIT GVIASYIYDK LKSHSERPTK SGWELNIKFQ KSKSSK                       46
//

If you have problems or comments...

PBIL Back to PBIL home page