(data stored in ACNUC9435 zone)

EMBL: AM180355.PE481

AM180355.PE481       Location/Qualifiers
FT   CDS             544648..545364
FT                   /transl_table=11
FT                   /locus_tag="CD630_04570"
FT                   /old_locus_tag="CD0457"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67285"
FT                   /db_xref="GOA:Q188P9"
FT                   /db_xref="UniProtKB/TrEMBL:Q188P9"
FT                   /protein_id="CAJ67285.1"
FT                   /translation="MILIVILSIFIIASINIIILGKENIRDIVIPLTLFIVSDFLFLCG
FT                   NIICRGGVMLLFIGLFAIPLMLIAFIWICVHMIKLYYKKDLNKRKMIGCIFSIFISIGT
FT                   IFIPSPSESFRFKLYEKDYSVVAKAILKVYDEKKLSSESVFYIQSDKNELEKIFSKEVI
FT                   KKMKKLNRNLDVVKISGNRNLVYFFFGAELQSIDGIVIFKDLKHVKPKLDFINRSIQAP
FT                   RLEYITNNVYYFKGEL"
     MILIVILSIF IIASINIIIL GKENIRDIVI PLTLFIVSDF LFLCGNIICR GGVMLLFIGL        60
     FAIPLMLIAF IWICVHMIKL YYKKDLNKRK MIGCIFSIFI SIGTIFIPSP SESFRFKLYE       120
     KDYSVVAKAI LKVYDEKKLS SESVFYIQSD KNELEKIFSK EVIKKMKKLN RNLDVVKISG       180
     NRNLVYFFFG AELQSIDGIV IFKDLKHVKP KLDFINRSIQ APRLEYITNN VYYFKGEL         238
//

If you have problems or comments...

PBIL Back to PBIL home page