(data stored in ACNUC9435 zone)

EMBL: AM180355.PE499

AM180355.PE499       Location/Qualifiers
FT   CDS             complement(565058..565684)
FT                   /transl_table=11
FT                   /locus_tag="CD630_04750"
FT                   /old_locus_tag="CD0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67303"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q188R4"
FT                   /protein_id="CAJ67303.1"
FT                   /translation="MKINIKSKLSEFIKQNNLFDDSRIISYLPNITIETDKIKTIMINE
FT                   VVPTNTNDDFYSVDKDADYLKTTIPLFDSAGIKVSNINDILDMGIYITNAVKLPKSEYT
FT                   ITRDTIKLHMPILEEEIKLFKNLEVVMLMGDVAKKSFNMITKKHIKKNVIPSISTYKLR
FT                   NNELYYDNLRVFPSYIMTGGNILIEKSKFEMASEDIKKMFEIING"
     MKINIKSKLS EFIKQNNLFD DSRIISYLPN ITIETDKIKT IMINEVVPTN TNDDFYSVDK        60
     DADYLKTTIP LFDSAGIKVS NINDILDMGI YITNAVKLPK SEYTITRDTI KLHMPILEEE       120
     IKLFKNLEVV MLMGDVAKKS FNMITKKHIK KNVIPSISTY KLRNNELYYD NLRVFPSYIM       180
     TGGNILIEKS KFEMASEDIK KMFEIING                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page