(data stored in ACNUC9435 zone)

EMBL: AM180355.PE521

AM180355.PE521       Location/Qualifiers
FT   CDS             586031..586417
FT                   /transl_table=11
FT                   /locus_tag="CD630_04970"
FT                   /old_locus_tag="CD0497"
FT                   /product="putative conjugative transposon protein DUF961
FT                   family Tn5397, CTn3-Orf22"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67326"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:Q188T7"
FT                   /protein_id="CAJ67326.1"
FT                   /translation="MRLANGIVLEKDATFGELKFSALRREVRIQNEDGSVSDEIKERTY
FT                   DLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPVADTVATATFQGADVDWYIKADDI
FT                   VLTKDSNSFRTQPQPKKEPVIDKQ"
     MRLANGIVLE KDATFGELKF SALRREVRIQ NEDGSVSDEI KERTYDLKSK GQGRMIQVSI        60
     PASVPLKEFD YNARVELINP VADTVATATF QGADVDWYIK ADDIVLTKDS NSFRTQPQPK       120
     KEPVIDKQ                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page