(data stored in ACNUC9435 zone)

EMBL: AM180355.PE525

AM180355.PE525       Location/Qualifiers
FT   CDS             589261..589482
FT                   /transl_table=11
FT                   /locus_tag="CD630_04991"
FT                   /old_locus_tag="CD0499A"
FT                   /product="putative conjugative transposon protein
FT                   Tn5397,CTn3-Orf19"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_04991"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67330"
FT                   /db_xref="GOA:Q188U7"
FT                   /db_xref="UniProtKB/TrEMBL:Q188U7"
FT                   /protein_id="CAJ67330.1"
FT                   /translation="MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLII
FT                   AIIAVGLVFNAAGVKDILLELFNRIIGA"
     MNFGQNLYNW FLSNAQSLVL LAIVVIGLYL GFKREFSKLI GFLIIAIIAV GLVFNAAGVK        60
     DILLELFNRI IGA                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page