(data stored in ACNUC9435 zone)

EMBL: AM180355.PE541

AM180355.PE541       Location/Qualifiers
FT   CDS             604190..604330
FT                   /transl_table=11
FT                   /locus_tag="CD630_05103"
FT                   /old_locus_tag="CD0510C"
FT                   /product="putative conjugative transposon protein
FT                   Tn5397,CTn3-Orf4"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_05103"
FT                   /db_xref="EnsemblGenomes-Tr:CCA62796"
FT                   /db_xref="UniProtKB/TrEMBL:F3Y5T1"
FT                   /protein_id="CCA62796.1"
FT                   /translation="MQENSQNKTMCIDNTKFYVISKFIGAVTLQHLIKRLIKNEVGQVV
FT                   K"
     MQENSQNKTM CIDNTKFYVI SKFIGAVTLQ HLIKRLIKNE VGQVVK                       46
//

If you have problems or comments...

PBIL Back to PBIL home page