(data stored in ACNUC9435 zone)

EMBL: AM180355.PE576

AM180355.PE576       Location/Qualifiers
FT   CDS             651171..651950
FT                   /transl_table=11
FT                   /locus_tag="CD630_05460"
FT                   /old_locus_tag="CD0546"
FT                   /product="putative membrane protein, DUF975 family"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67379"
FT                   /db_xref="GOA:Q188Z3"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q188Z3"
FT                   /protein_id="CAJ67379.1"
FT                   /translation="MVSRQELKRVSKAQLSGNWGICAISMAVYIALIVLISIVGLPFEP
FT                   LTTIVVAVIAFCVSAGFTCMFLKITKDEKVKIGDIFVSGRIYLRSFGFYLFESIIVYIY
FT                   SFIITIIGAFLSFGVLLTSGAIEYLSSDNVGIGTIISTGITLVLIILVLMLPVYILLLY
FT                   VSQATFLICEDKDNMGVFKSMGASLDMMKGNVLKLFVLNFSFIGWYILSIATLGIGLLW
FT                   LIPYVGVTNCNFYRQLVKENPDVEDILLDKEKSYTMY"
     MVSRQELKRV SKAQLSGNWG ICAISMAVYI ALIVLISIVG LPFEPLTTIV VAVIAFCVSA        60
     GFTCMFLKIT KDEKVKIGDI FVSGRIYLRS FGFYLFESII VYIYSFIITI IGAFLSFGVL       120
     LTSGAIEYLS SDNVGIGTII STGITLVLII LVLMLPVYIL LLYVSQATFL ICEDKDNMGV       180
     FKSMGASLDM MKGNVLKLFV LNFSFIGWYI LSIATLGIGL LWLIPYVGVT NCNFYRQLVK       240
     ENPDVEDILL DKEKSYTMY                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page