(data stored in ACNUC9435 zone)

EMBL: AM180355.PE587

AM180355.PE587       Location/Qualifiers
FT   CDS             662767..664434
FT                   /transl_table=11
FT                   /locus_tag="CD630_05570"
FT                   /old_locus_tag="CD0557"
FT                   /product="putative uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: down-regulated in Spo0A
FT                   mutant PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67390"
FT                   /db_xref="GOA:Q189A1"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q189A1"
FT                   /protein_id="CAJ67390.1"
FT                   /translation="MKKINLKIEGKDKEYSLEENSPGIRLGDIAKEFCDEHKGYITLAV
FT                   VDNKLKELNCRVKKDCEINFLDTTNEDGERVYFRVMSFIFVMACREIFWDSRVTIEHSL
FT                   SDGLYCEVHIDRKLKEADVENIKNKMKEIVNNDYVIEKIEVTRNEAISIFENNEMYEKA
FT                   ELLKYKEYDSAKVYKCRNYIDHFYGYMLPSTGYIKSFDIKLYNGGVIILGPSEEDKTLP
FT                   MKFVPQPKLSSVYYEAEEWSRLMGIDKVVSLNKIIENNEYGDIIRTFEALHEKKLSQIA
FT                   DMIKDGNKRVVLIAAPSSSGKTSFAHRLSIHLRVNNLNPISISLDDYFIDRKHTPLDEY
FT                   GNYDFESIYAIDLEKFNLDLKKLLAGEEIDDIRFNFKEGKREYTGKKIKIDSNQPIILE
FT                   GIHGLNPILTSSIPDEDKFKIYISALTQINLDDHNRIPTADLRMIRRIVRDYNFRGYSA
FT                   DNTILQWASVRRGEKKNIFPYQEEADAIFNSACVYELAVLKRFAKPLLEEIKEDNPAHI
FT                   EATRLLKFLQYFVELDDTSDIPGISILREFIGGSKIVD"
     MKKINLKIEG KDKEYSLEEN SPGIRLGDIA KEFCDEHKGY ITLAVVDNKL KELNCRVKKD        60
     CEINFLDTTN EDGERVYFRV MSFIFVMACR EIFWDSRVTI EHSLSDGLYC EVHIDRKLKE       120
     ADVENIKNKM KEIVNNDYVI EKIEVTRNEA ISIFENNEMY EKAELLKYKE YDSAKVYKCR       180
     NYIDHFYGYM LPSTGYIKSF DIKLYNGGVI ILGPSEEDKT LPMKFVPQPK LSSVYYEAEE       240
     WSRLMGIDKV VSLNKIIENN EYGDIIRTFE ALHEKKLSQI ADMIKDGNKR VVLIAAPSSS       300
     GKTSFAHRLS IHLRVNNLNP ISISLDDYFI DRKHTPLDEY GNYDFESIYA IDLEKFNLDL       360
     KKLLAGEEID DIRFNFKEGK REYTGKKIKI DSNQPIILEG IHGLNPILTS SIPDEDKFKI       420
     YISALTQINL DDHNRIPTAD LRMIRRIVRD YNFRGYSADN TILQWASVRR GEKKNIFPYQ       480
     EEADAIFNSA CVYELAVLKR FAKPLLEEIK EDNPAHIEAT RLLKFLQYFV ELDDTSDIPG       540
     ISILREFIGG SKIVD                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page