(data stored in ACNUC9435 zone)

EMBL: AM180355.PE99

AM180355.PE99        Location/Qualifiers
FT   CDS             114647..114916
FT                   /transl_table=11
FT                   /locus_tag="CD630_00930"
FT                   /old_locus_tag="CD0093"
FT                   /product="Ribosomal protein L14E/L6E/L27E-like"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66911"
FT                   /db_xref="GOA:Q18CI3"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CI3"
FT                   /protein_id="CAJ66911.2"
FT                   /translation="MLSDNLSIGQVVKVSLGRDKGNLFFVVKIINNEYVLIADGKKRKL
FT                   DKPKLKKVKHLKKYNFINDEVRKRVVSGQEITDSFLRAELTKLN"
     MLSDNLSIGQ VVKVSLGRDK GNLFFVVKII NNEYVLIADG KKRKLDKPKL KKVKHLKKYN        60
     FINDEVRKRV VSGQEITDSF LRAELTKLN                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page