(data stored in ACNUC9435 zone)

EMBL: AM180355.PURE

AM180355.PURE        Location/Qualifiers
FT   CDS             281723..282199
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="CD630_02180"
FT                   /old_locus_tag="CD0218"
FT                   /product="Phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67039"
FT                   /db_xref="GOA:Q18CV6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CV6"
FT                   /protein_id="CAJ67039.1"
FT                   /translation="MKVAVVMGSKSDYPKLEEGIKLLEKYGIEVVARALSAHRTPEQLS
FT                   IFLKEIEDDTDVIIAAAGKAAHLPGVIASQTLIPVIGLPIKSSTMDGLDSLLSIVQMPK
FT                   GIPVATVTIDLGLNAALLALQIMTLKYPKLKEDLKSYREEMAQKVLEDDKNLRG"
     MKVAVVMGSK SDYPKLEEGI KLLEKYGIEV VARALSAHRT PEQLSIFLKE IEDDTDVIIA        60
     AAGKAAHLPG VIASQTLIPV IGLPIKSSTM DGLDSLLSIV QMPKGIPVAT VTIDLGLNAA       120
     LLALQIMTLK YPKLKEDLKS YREEMAQKVL EDDKNLRG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page