(data stored in ACNUC9435 zone)

EMBL: AM180355.RBSB

AM180355.RBSB        Location/Qualifiers
FT   CDS             361084..362046
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="CD630_03000"
FT                   /old_locus_tag="CD0300"
FT                   /product="ABC-type transport system, ribose-specific
FT                   extracellular solute-binding protein"
FT                   /note="experimentally verified through RNA-seq as part of
FT                   Spo0A regulated transcriptome: up-regulated in Spo0A mutant
FT                   PMID:24568651"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ67122"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q18D38"
FT                   /protein_id="CAJ67122.1"
FT                   /translation="MRVRKILSLGIAGILAIGMLTGCSMEGPSKSDNKGGSDKKDLTIG
FT                   VSTITLQHQFFIDIDEGIKEKAKELGVKVIVNDPDQDVAKQTSAIEDFIQQNVDGMIVL
FT                   GTDNSAIVPAVEGAFEKMPVVTVDAVLNTENITSYVGTVSYDAGKKLGEYTKKYIDEKL
FT                   GGKSEIAIVTDLKSQIQMQRIDGFKDALKGSANVKILNSQPGYDREESLNTVENLIQSN
FT                   PDVDIIYATAENSVLGAKAALESAKNKDVKIVGFDLTEEASSGITDGTILAMIQQQPKE
FT                   MGRLAVEAVVKAIKGEKVEKNIPVPALLYDKENIKDFKN"
     MRVRKILSLG IAGILAIGML TGCSMEGPSK SDNKGGSDKK DLTIGVSTIT LQHQFFIDID        60
     EGIKEKAKEL GVKVIVNDPD QDVAKQTSAI EDFIQQNVDG MIVLGTDNSA IVPAVEGAFE       120
     KMPVVTVDAV LNTENITSYV GTVSYDAGKK LGEYTKKYID EKLGGKSEIA IVTDLKSQIQ       180
     MQRIDGFKDA LKGSANVKIL NSQPGYDREE SLNTVENLIQ SNPDVDIIYA TAENSVLGAK       240
     AALESAKNKD VKIVGFDLTE EASSGITDGT ILAMIQQQPK EMGRLAVEAV VKAIKGEKVE       300
     KNIPVPALLY DKENIKDFKN                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page