(data stored in ACNUC9435 zone)

EMBL: AM180355.RPLD

AM180355.RPLD        Location/Qualifiers
FT   CDS             103543..104166
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="CD630_00740"
FT                   /old_locus_tag="CD0074"
FT                   /product="50S ribosomal protein L4"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66889"
FT                   /db_xref="GOA:Q18CF9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:Q18CF9"
FT                   /protein_id="CAJ66889.2"
FT                   /translation="MPKLNVLNVSGQNVGEIELSDSIFGVEVNGHVLYEVVKNQLANKR
FT                   QGTQSAKTRAEVRGGGRKPWKQKGTGRARQGSTRSVQWVGGGVAFAPKPRSYKYTLPKK
FT                   VRRLAMKSALSSKVQNSEVIVLDALNMDAPKTKEFAQILNNINAAKKALVVIADKNDNV
FT                   IKSARNIEGVQTALVNTMNVYDILKYDSFIITTDAVKKVEEVYA"
     MPKLNVLNVS GQNVGEIELS DSIFGVEVNG HVLYEVVKNQ LANKRQGTQS AKTRAEVRGG        60
     GRKPWKQKGT GRARQGSTRS VQWVGGGVAF APKPRSYKYT LPKKVRRLAM KSALSSKVQN       120
     SEVIVLDALN MDAPKTKEFA QILNNINAAK KALVVIADKN DNVIKSARNI EGVQTALVNT       180
     MNVYDILKYD SFIITTDAVK KVEEVYA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page