(data stored in ACNUC9435 zone)

EMBL: AM180355.RPLF

AM180355.RPLF        Location/Qualifiers
FT   CDS             109747..110289
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="CD630_00860"
FT                   /old_locus_tag="CD0086"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66903"
FT                   /db_xref="GOA:Q18CH5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CH5"
FT                   /protein_id="CAJ66903.1"
FT                   /translation="MSRIGVKPIIIPAGVEVTIAEGNLVTVKGPKGTLTKQLSAELNIK
FT                   KEENTIMVERPTDNKKHRSLHGLTRTLLDNMVVGVNTGFEKKLELKGVGYRAQKQGKKL
FT                   VMNLGFSHPVEMEDPEGITVEAPNQTELIVKGIDKQLVGNYAAKIRAWRKPEPYKGKGI
FT                   KYVDEVIRRKEGKTGKK"
     MSRIGVKPII IPAGVEVTIA EGNLVTVKGP KGTLTKQLSA ELNIKKEENT IMVERPTDNK        60
     KHRSLHGLTR TLLDNMVVGV NTGFEKKLEL KGVGYRAQKQ GKKLVMNLGF SHPVEMEDPE       120
     GITVEAPNQT ELIVKGIDKQ LVGNYAAKIR AWRKPEPYKG KGIKYVDEVI RRKEGKTGKK       180
//

If you have problems or comments...

PBIL Back to PBIL home page