(data stored in ACNUC9435 zone)

EMBL: AM180355.RPLJ

AM180355.RPLJ        Location/Qualifiers
FT   CDS             87581..88087
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="CD630_00630"
FT                   /old_locus_tag="CD0063"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Experimentally verified as part of mature spore
FT                   proteome PMID:19542279"
FT                   /db_xref="EnsemblGenomes-Gn:CD630_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ66878"
FT                   /db_xref="GOA:Q18CE8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18CE8"
FT                   /protein_id="CAJ66878.1"
FT                   /translation="MRKAIEIKSEVVSEIVEKLQKSSAAVVVDYKGLTVEEVTELRKQM
FT                   REAGVDYKVYKNTLVRRAAKEVGIEQFNDELLVGTNAIAFGYDDPVAPARILKGFMDSH
FT                   PKMKLKMGIVEGAFYDESKIVEMANIPSREVLIAKLLGSLKAPVSNFAYLIDAIAKKAE
FT                   GQEEA"
     MRKAIEIKSE VVSEIVEKLQ KSSAAVVVDY KGLTVEEVTE LRKQMREAGV DYKVYKNTLV        60
     RRAAKEVGIE QFNDELLVGT NAIAFGYDDP VAPARILKGF MDSHPKMKLK MGIVEGAFYD       120
     ESKIVEMANI PSREVLIAKL LGSLKAPVSN FAYLIDAIAK KAEGQEEA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page